Lineage for d6xd8a1 (6xd8 A:129-221)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548747Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2548748Protein automated matches [191162] (29 species)
    not a true protein
  7. 2548749Species Bacillus anthracis [TaxId:260799] [388798] (1 PDB entry)
  8. 2548750Domain d6xd8a1: 6xd8 A:129-221 [388813]
    Other proteins in same PDB: d6xd8a2, d6xd8b2
    automated match to d2lj4a_

Details for d6xd8a1

PDB Entry: 6xd8 (more details), 1.52 Å

PDB Description: crystal structure of peptidylprolyl isomerase (prsa) fragment from bacillus anthracis
PDB Compounds: (A:) Foldase protein PrsA 1

SCOPe Domain Sequences for d6xd8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xd8a1 d.26.1.0 (A:129-221) automated matches {Bacillus anthracis [TaxId: 260799]}
mkpeikashilvkdeatakkvkeelgqgksfeelakqysedtgskekggdlgffgagkmv
kefedaayklkkdevsepvksqfgyhiikvtdi

SCOPe Domain Coordinates for d6xd8a1:

Click to download the PDB-style file with coordinates for d6xd8a1.
(The format of our PDB-style files is described here.)

Timeline for d6xd8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6xd8a2