Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Bacillus anthracis [TaxId:260799] [388798] (1 PDB entry) |
Domain d6xd8a1: 6xd8 A:129-221 [388813] Other proteins in same PDB: d6xd8a2, d6xd8b2 automated match to d2lj4a_ |
PDB Entry: 6xd8 (more details), 1.52 Å
SCOPe Domain Sequences for d6xd8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xd8a1 d.26.1.0 (A:129-221) automated matches {Bacillus anthracis [TaxId: 260799]} mkpeikashilvkdeatakkvkeelgqgksfeelakqysedtgskekggdlgffgagkmv kefedaayklkkdevsepvksqfgyhiikvtdi
Timeline for d6xd8a1: