SCOPe 2.07: Domain d7c2lm2: 7c2l M:112-219

Lineage for d7c2lm2 (7c2l M:112-219)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d7c2lm2: 7c2l M:112-219 [388735]
   Other proteins in same PDB: d7c2ll1, d7c2lm1, d7c2ln1
   automated match to d1dn0a2
   complexed with nag

Details for d7c2lm2

PDB Entry: 7c2l, 3.1 Å

PDB Description: s protein of sars-cov-2 in complex bound with 4a8

PDB Compounds: (M:) light chain of 4A8

SCOPe Domain Sequences for d7c2lm2:

Sequence; same for both SEQRES and ATOM records:

>d7c2lm2 b.1.1.2 (M:112-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d7c2lm2:

• d7c2lm2 is new in SCOPe 2.07-stable
  
• d7c2lm2 appears in the current release, SCOPe 2.08