Lineage for d6x1qb2 (6x1q B:220-333)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373157Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2373160Domain d6x1qb2: 6x1q B:220-333 [388718]
    Other proteins in same PDB: d6x1qa1, d6x1qa3, d6x1qa5, d6x1qb1, d6x1qb3, d6x1qb5, d6x1qc1, d6x1qc3, d6x1qc5, d6x1qd1, d6x1qd3, d6x1qd5
    automated match to d1jz8a1
    complexed with mg, na

Details for d6x1qb2

PDB Entry: 6x1q (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution structure of b-galactosidase with a 200 kv cryoarm electron microscope
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6x1qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x1qb2 b.1.4.0 (B:220-333) automated matches {Escherichia coli [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d6x1qb2:

Click to download the PDB-style file with coordinates for d6x1qb2.
(The format of our PDB-style files is described here.)

Timeline for d6x1qb2: