SCOPe 2.04: Domain d1ec9b2: 1ec9 B:4-137

Lineage for d1ec9b2 (1ec9 B:4-137)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein D-glucarate dehydratase [54831] (2 species)

7. Species Escherichia coli [TaxId:562] [54833] (7 PDB entries)

8. Domain d1ec9b2: 1ec9 B:4-137 [38871]
   Other proteins in same PDB: d1ec9a1, d1ec9b1, d1ec9c1, d1ec9d1
   complexed with ipa, mg, xyh

Details for d1ec9b2

PDB Entry: 1ec9, 2 Å

PDB Description: e. coli glucarate dehydratase bound to xylarohydroxamate

PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d1ec9b2:

Sequence; same for both SEQRES and ATOM records:

>d1ec9b2 d.54.1.1 (B:4-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
lgqhlgvnvasllg

Timeline for d1ec9b2:

• d1ec9b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ec9b2 appears in SCOPe 2.03
  
• d1ec9b2 appears in SCOPe 2.05
  
• d1ec9b2 appears in the current release, SCOPe 2.08