SCOPe 2.07: Domain d6v2fb1: 6v2f B:1-147

Lineage for d6v2fb1 (6v2f B:1-147)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d6v2fb1: 6v2f B:1-147 [388667]
   Other proteins in same PDB: d6v2fa2, d6v2fb2, d6v2fc2, d6v2fd2, d6v2fe2, d6v2ff2
   automated match to d4xfxa1
   complexed with qng

Details for d6v2fb1

PDB Entry: 6v2f, 2 Å

PDB Description: crystal structure of the hiv capsid hexamer bound to the small molecule long-acting inhibitor, gs-6207

PDB Compounds: (B:) hiv-1 capsid

SCOPe Domain Sequences for d6v2fb1:

Sequence, based on SEQRES records:

>d6v2fb1 a.73.1.1 (B:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d6v2fb1 a.73.1.1 (B:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvgghqaam
qmlketineeaaewdrlhpapgqmreprgsdiagttstlqeqigwmthnppipvgeiykr
wiilglnkivrmysp

Timeline for d6v2fb1:

• d6v2fb1 is new in SCOPe 2.07-stable
  
• d6v2fb1 appears in the current release, SCOPe 2.08