Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (13 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [230381] (2 PDB entries) |
Domain d6uiod_: 6uio D: [388632] automated match to d1roaa_ complexed with cl, i2i, iod, mes, na, so4 |
PDB Entry: 6uio (more details), 1.83 Å
SCOPe Domain Sequences for d6uiod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uiod_ d.17.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nyfgsinisnanvkqavwfamkeynkesedkyvflvdkilhaklqitdrmeyqidvqisr snckkplnntencipqkkpelekkmscsflvgalpwngefnllskeckdv
Timeline for d6uiod_: