Lineage for d6uiod_ (6uio D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2542784Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2542960Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2542961Protein automated matches [190558] (13 species)
    not a true protein
  7. 2543010Species Mouse (Mus musculus) [TaxId:10090] [230381] (2 PDB entries)
  8. 2543015Domain d6uiod_: 6uio D: [388632]
    automated match to d1roaa_
    complexed with cl, i2i, iod, mes, na, so4

Details for d6uiod_

PDB Entry: 6uio (more details), 1.83 Å

PDB Description: crystal structure of mouse cres (cystatin-related epididymal spermatogenic)
PDB Compounds: (D:) Cystatin-8

SCOPe Domain Sequences for d6uiod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uiod_ d.17.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nyfgsinisnanvkqavwfamkeynkesedkyvflvdkilhaklqitdrmeyqidvqisr
snckkplnntencipqkkpelekkmscsflvgalpwngefnllskeckdv

SCOPe Domain Coordinates for d6uiod_:

Click to download the PDB-style file with coordinates for d6uiod_.
(The format of our PDB-style files is described here.)

Timeline for d6uiod_: