Lineage for d6u3ug_ (6u3u G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398373Protein automated matches [190381] (11 species)
    not a true protein
  7. 2398413Species Escherichia coli [TaxId:562] [187229] (8 PDB entries)
  8. 2398473Domain d6u3ug_: 6u3u G: [388629]
    Other proteins in same PDB: d6u3ua_, d6u3ub_
    automated match to d2ga4b_
    complexed with edo, epe, zn

Details for d6u3ug_

PDB Entry: 6u3u (more details), 2.29 Å

PDB Description: crystal structure of shiga toxin 2k
PDB Compounds: (G:) Shiga toxin 2K subunit B

SCOPe Domain Sequences for d6u3ug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u3ug_ b.40.2.1 (G:) automated matches {Escherichia coli [TaxId: 562]}
adcakgkiefskynendtftvkvagkeywtnrwnlqpllqsaqltgmtvtiksstcasgs
gfaevqfnnd

SCOPe Domain Coordinates for d6u3ug_:

Click to download the PDB-style file with coordinates for d6u3ug_.
(The format of our PDB-style files is described here.)

Timeline for d6u3ug_: