Lineage for d6owva1 (6owv A:23-145)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487517Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2487701Domain d6owva1: 6owv A:23-145 [388527]
    automated match to d1sjia1
    complexed with cl, so4

Details for d6owva1

PDB Entry: 6owv (more details), 1.88 Å

PDB Description: crystal structure of a human cardiac calsequestrin filament
PDB Compounds: (A:) calsequestrin-2

SCOPe Domain Sequences for d6owva1:

Sequence, based on SEQRES records: (download)

>d6owva1 c.47.1.0 (A:23-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnfptydgkdrvvslseknfkqvlkkydllclyyhepvssdkvtqkqfqlkeivlelvaq
vlehkaigfvmvdakkeaklakklgfdeegslyilkgdrtiefdgefaadvlveflldli
edp

Sequence, based on observed residues (ATOM records): (download)

>d6owva1 c.47.1.0 (A:23-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnfptydgkdrvvslseknfkqvlkkydllclyyhqfqlkeivlelvaqvlehkaigfvm
vdakkeaklakklgfdeegslyilkgdrtiefdgefaadvlveflldliedp

SCOPe Domain Coordinates for d6owva1:

Click to download the PDB-style file with coordinates for d6owva1.
(The format of our PDB-style files is described here.)

Timeline for d6owva1: