Lineage for d6krqd_ (6krq D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485823Protein automated matches [190100] (20 species)
    not a true protein
  7. 2485834Species Aeropyrum pernix [TaxId:272557] [186846] (19 PDB entries)
  8. 2485967Domain d6krqd_: 6krq D: [388488]
    automated match to d1x0rb_
    complexed with cit; mutant

Details for d6krqd_

PDB Entry: 6krq (more details), 2.1 Å

PDB Description: peroxiredoxin from aeropyrum pernix k1 (apprx) 0cys f80a mutant
PDB Compounds: (D:) peroxiredoxin

SCOPe Domain Sequences for d6krqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6krqd_ c.47.1.10 (D:) automated matches {Aeropyrum pernix [TaxId: 272557]}
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvsttefvsfarry
edfqrlgvdliglsvdsvashikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrsldwwfswdtpasrddveearrylrraaekpakll
yeea

SCOPe Domain Coordinates for d6krqd_:

Click to download the PDB-style file with coordinates for d6krqd_.
(The format of our PDB-style files is described here.)

Timeline for d6krqd_: