Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
Protein automated matches [191144] (3 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231239] (5 PDB entries) |
Domain d6kd6a_: 6kd6 A: [388486] Other proteins in same PDB: d6kd6b2 automated match to d2m16a_ |
PDB Entry: 6kd6 (more details), 1.58 Å
SCOPe Domain Sequences for d6kd6a_:
Sequence, based on SEQRES records: (download)
>d6kd6a_ b.34.9.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} asysigdlvfakvkgyppwpakitksnnnkkynvyfygtgetanikledlfpyasnkerf atekimkrakfieaidqiesal
>d6kd6a_ b.34.9.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} asysigdlvfakvkgyppwpakitksnkkynvyfygtgetanikledlfpyasnkerfat ekimkrakfieaidqiesal
Timeline for d6kd6a_:
View in 3D Domains from other chains: (mouse over for more information) d6kd6b1, d6kd6b2, d6kd6c_, d6kd6d_ |