Lineage for d6xepa2 (6xep A:139-312)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584675Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2584676Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2584750Family d.139.1.0: automated matches [227182] (1 protein)
    not a true family
  6. 2584751Protein automated matches [226902] (12 species)
    not a true protein
  7. 2584783Species Stenotrophomonas maltophilia [TaxId:522373] [388343] (1 PDB entry)
  8. 2584784Domain d6xepa2: 6xep A:139-312 [388344]
    Other proteins in same PDB: d6xepa1, d6xepa3
    automated match to d5cm7a2
    complexed with edo, na

Details for d6xepa2

PDB Entry: 6xep (more details), 1.8 Å

PDB Description: crystal structure of thiamine-monophosphate kinase from stenotrophomonas maltophilia k279a
PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d6xepa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xepa2 d.139.1.0 (A:139-312) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
rgqalrrdraqlgddiwvsgtlgdaagalrlwqqgalnlatatlladyeslrlrllrptp
rvtlglrlrafahaavdvsdglladlghiaarsnvaahvdadslpishalrellgrddar
dcalrggddyelcftaaadqrdalhylaesldlpltrigriadgqgvhvdgeaa

SCOPe Domain Coordinates for d6xepa2:

Click to download the PDB-style file with coordinates for d6xepa2.
(The format of our PDB-style files is described here.)

Timeline for d6xepa2: