Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) |
Family d.139.1.0: automated matches [227182] (1 protein) not a true family |
Protein automated matches [226902] (12 species) not a true protein |
Species Stenotrophomonas maltophilia [TaxId:522373] [388343] (1 PDB entry) |
Domain d6xepa2: 6xep A:139-312 [388344] Other proteins in same PDB: d6xepa1, d6xepa3 automated match to d5cm7a2 complexed with edo, na |
PDB Entry: 6xep (more details), 1.8 Å
SCOPe Domain Sequences for d6xepa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xepa2 d.139.1.0 (A:139-312) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]} rgqalrrdraqlgddiwvsgtlgdaagalrlwqqgalnlatatlladyeslrlrllrptp rvtlglrlrafahaavdvsdglladlghiaarsnvaahvdadslpishalrellgrddar dcalrggddyelcftaaadqrdalhylaesldlpltrigriadgqgvhvdgeaa
Timeline for d6xepa2: