Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies) |
Superfamily d.52.2: GMP synthetase, C-terminal, dimerisation domain [54810] (1 family) |
Family d.52.2.1: GMP synthetase, C-terminal, dimerisation domain [54811] (1 protein) |
Protein GMP synthetase, C-terminal, dimerisation domain [54812] (1 species) |
Species Escherichia coli [TaxId:562] [54813] (1 PDB entry) |
Domain d1gpmc3: 1gpm C:405-525 [38828] Other proteins in same PDB: d1gpma1, d1gpma2, d1gpmb1, d1gpmb2, d1gpmc1, d1gpmc2, d1gpmd1, d1gpmd2 |
PDB Entry: 1gpm (more details), 2.2 Å
SCOP Domain Sequences for d1gpmc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpmc3 d.52.2.1 (C:405-525) GMP synthetase, C-terminal, dimerisation domain {Escherichia coli} gpglgvrvlgevkkeycdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgr kydwvvslravetidfmtahwahlpydflgrvsnriinevngisrvvydisgkppatiew e
Timeline for d1gpmc3: