Lineage for d6k9nb_ (6k9n B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534811Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2534812Protein automated matches [190230] (23 species)
    not a true protein
  7. 2534979Species Oryza sativa [TaxId:39947] [388123] (3 PDB entries)
  8. 2534982Domain d6k9nb_: 6k9n B: [388210]
    automated match to d4dhib_

Details for d6k9nb_

PDB Entry: 6k9n (more details), 2.27 Å

PDB Description: rice_otub_like_catalytic domain
PDB Compounds: (B:) ubiquitin thioesterase

SCOPe Domain Sequences for d6k9nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k9nb_ d.3.1.0 (B:) automated matches {Oryza sativa [TaxId: 39947]}
lpyvgdkeplstlaaefqsgspilqekikllgeqydalrrtrgdgncfyrsfmfsylehi
letqdkaeverilkkieqckktladlgyieftfedffsifidqlesvlqghessigaeel
lertrdqmvsdyvvmffrfvtsgeiqrraeffepfisgltnstvvqfckasvepmgeesd
hvhiialsdalgvpirvmyldrsscdagnisvnhhdfspeanssdgaaaaekpyitllyr
pghydilypk

SCOPe Domain Coordinates for d6k9nb_:

Click to download the PDB-style file with coordinates for d6k9nb_.
(The format of our PDB-style files is described here.)

Timeline for d6k9nb_: