Lineage for d6oqrd3 (6oqr D:344-459)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717625Species Escherichia coli [TaxId:562] [388137] (2 PDB entries)
  8. 2717629Domain d6oqrd3: 6oqr D:344-459 [388182]
    Other proteins in same PDB: d6oqrd1, d6oqrd2, d6oqre1, d6oqre2, d6oqrf1, d6oqrf2, d6oqrg_, d6oqrh1, d6oqrh2, d6oqri_, d6oqrj_, d6oqrl_, d6oqrm_, d6oqrn_, d6oqro_, d6oqrp_, d6oqrq_, d6oqrr_, d6oqrs_
    automated match to d4q4la3
    complexed with adp, atp, mg, po4

Details for d6oqrd3

PDB Entry: 6oqr (more details), 3.1 Å

PDB Description: e. coli atp synthase adp state 1a
PDB Compounds: (D:) ATP synthase subunit beta

SCOPe Domain Sequences for d6oqrd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oqrd3 a.69.1.0 (D:344-459) automated matches {Escherichia coli [TaxId: 562]}
ldplvvgqehydtargvqsilqryqelkdiiailgmdelseedklvvararkiqrflsqp
ffvaevftgspgkyvslkdtirgfkgimegeydhlpeqafymvgsieeavekakkl

SCOPe Domain Coordinates for d6oqrd3:

Click to download the PDB-style file with coordinates for d6oqrd3.
(The format of our PDB-style files is described here.)

Timeline for d6oqrd3: