SCOPe 2.07: Domain d6pk8a1: 6pk8 A:2-116

Lineage for d6pk8a1 (6pk8 A:2-116)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (28 PDB entries)
Domain d6pk8a1: 6pk8 A:2-116 [388170]
automated match to d5i4fa1
complexed with so4

Details for d6pk8a1

PDB Entry: 6pk8 (more details), 2.91 Å

PDB Description: antibody scfv-m204 dimeric state

PDB Compounds: (A:) scFv-M204 antibody

SCOPe Domain Sequences for d6pk8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pk8a1 b.1.1.0 (A:2-116) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aqsveesggrlvtpgtpltlactvsgfslntysmfwvrqapgkglqwigiisnfgviyya
twakgrftisktsttvdlkitspttedtatyfcvrkygsewggdlwgpgtlvtvs

SCOPe Domain Coordinates for d6pk8a1:

Click to download the PDB-style file with coordinates for d6pk8a1.
(The format of our PDB-style files is described here.)

Timeline for d6pk8a1: