SCOPe 2.07: Domain d6vtcb2: 6vtc B:115-243

Lineage for d6vtcb2 (6vtc B:115-243)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6vtcb2: 6vtc B:115-243 [388036]
   Other proteins in same PDB: d6vtca2
   automated match to d3q5ya2

Details for d6vtcb2

PDB Entry: 6vtc, 1.83 Å

PDB Description: p53-specific t cell receptor

PDB Compounds: (B:) p53-specific T cell receptor, B-chain

SCOPe Domain Sequences for d6vtcb2:

Sequence; same for both SEQRES and ATOM records:

>d6vtcb2 b.1.1.0 (B:115-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d6vtcb2:

• d6vtcb2 is new in SCOPe 2.07-stable
  
• d6vtcb2 appears in the current release, SCOPe 2.08