SCOPe 2.07: Domain d6vkkc2: 6vkk C:797-1011

Lineage for d6vkkc2 (6vkk C:797-1011)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)

8. Domain d6vkkc2: 6vkk C:797-1011 [387936]
   Other proteins in same PDB: d6vkka1, d6vkkb1, d6vkkc1, d6vkkd1
   automated match to d4hhyd2
   complexed with gol, rpb, so4

Details for d6vkkc2

PDB Entry: 6vkk, 2.1 Å

PDB Description: crystal structure of human parp-1 cat domain bound to inhibitor rucaparib

PDB Compounds: (C:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6vkkc2:

Sequence; same for both SEQRES and ATOM records:

>d6vkkc2 d.166.1.0 (C:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

Timeline for d6vkkc2:

• d6vkkc2 is new in SCOPe 2.07-stable
  
• d6vkkc2 appears in the current release, SCOPe 2.08