Lineage for d6v47d_ (6v47 D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646440Species Influenza a virus (a/duck/memphis/546/1974(h11n9)) [TaxId:402474] [387930] (1 PDB entry)
  8. 2646442Domain d6v47d_: 6v47 D: [387931]
    Other proteins in same PDB: d6v47a_, d6v47c_, d6v47e_
    automated match to d3m5jb_
    complexed with nag

Details for d6v47d_

PDB Entry: 6v47 (more details), 2.8 Å

PDB Description: the crystal structure of hemagglutinin from a/duck/memphis/546/1974 (h11n9)
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6v47d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v47d_ h.3.1.0 (D:) automated matches {Influenza a virus (a/duck/memphis/546/1974(h11n9)) [TaxId: 402474]}
agfieggwpglingwygfqhrneegtgiaadkestqtaidqitskvnnivdrmntnfesv
qhefseieerinqlskhvddsvidiwsynaqllvllenektldlhdsnvrnlhekvrrml
kdnakdegngcftfyhkcdneciekvrngtydhkefeeesrlnrqei

SCOPe Domain Coordinates for d6v47d_:

Click to download the PDB-style file with coordinates for d6v47d_.
(The format of our PDB-style files is described here.)

Timeline for d6v47d_: