Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza a virus (a/duck/memphis/546/1974(h11n9)) [TaxId:402474] [387930] (1 PDB entry) |
Domain d6v47d_: 6v47 D: [387931] Other proteins in same PDB: d6v47a_, d6v47c_, d6v47e_ automated match to d3m5jb_ complexed with nag |
PDB Entry: 6v47 (more details), 2.8 Å
SCOPe Domain Sequences for d6v47d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v47d_ h.3.1.0 (D:) automated matches {Influenza a virus (a/duck/memphis/546/1974(h11n9)) [TaxId: 402474]} agfieggwpglingwygfqhrneegtgiaadkestqtaidqitskvnnivdrmntnfesv qhefseieerinqlskhvddsvidiwsynaqllvllenektldlhdsnvrnlhekvrrml kdnakdegngcftfyhkcdneciekvrngtydhkefeeesrlnrqei
Timeline for d6v47d_: