Lineage for d6v46d_ (6v46 D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646548Species Influenza a virus (strain a/turkey/ontario/6118/1968 h8n4) [TaxId:311175] [387908] (1 PDB entry)
  8. 2646550Domain d6v46d_: 6v46 D: [387927]
    Other proteins in same PDB: d6v46a_, d6v46c_, d6v46e_
    automated match to d3m5jb_
    complexed with fuc, nag

Details for d6v46d_

PDB Entry: 6v46 (more details), 2.25 Å

PDB Description: the crystal structure of hemagglutinin from a/turkey/ontario/6118/1968 (h8n4)
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6v46d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v46d_ h.3.1.0 (D:) automated matches {Influenza a virus (strain a/turkey/ontario/6118/1968 h8n4) [TaxId: 311175]}
iagfieggwsgmidgwygfhhsnsegtgmaadqkstqeaidkitnkvnnivdkmnrefev
vnhefsevekrinmindkiddqiedlwaynaellvllenqktldehdsnvknlfdevkrr
lsanaidagngcfdilhkcdnecmetikngtydhkeyeeeaklers

SCOPe Domain Coordinates for d6v46d_:

Click to download the PDB-style file with coordinates for d6v46d_.
(The format of our PDB-style files is described here.)

Timeline for d6v46d_: