Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza a virus (strain a/turkey/ontario/6118/1968 h8n4) [TaxId:311175] [387908] (1 PDB entry) |
Domain d6v46d_: 6v46 D: [387927] Other proteins in same PDB: d6v46a_, d6v46c_, d6v46e_ automated match to d3m5jb_ complexed with fuc, nag |
PDB Entry: 6v46 (more details), 2.25 Å
SCOPe Domain Sequences for d6v46d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v46d_ h.3.1.0 (D:) automated matches {Influenza a virus (strain a/turkey/ontario/6118/1968 h8n4) [TaxId: 311175]} iagfieggwsgmidgwygfhhsnsegtgmaadqkstqeaidkitnkvnnivdkmnrefev vnhefsevekrinmindkiddqiedlwaynaellvllenqktldehdsnvknlfdevkrr lsanaidagngcfdilhkcdnecmetikngtydhkeyeeeaklers
Timeline for d6v46d_: