Lineage for d6v49c1 (6v49 C:1-328)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386069Species Influenza a virus (a/wedge-tailed shearwater/western australia/2576/1979(h15n9)) [TaxId:352560] [387916] (1 PDB entry)
  8. 2386071Domain d6v49c1: 6v49 C:1-328 [387917]
    Other proteins in same PDB: d6v49a2, d6v49b_, d6v49c2, d6v49d_, d6v49e2, d6v49f_
    automated match to d3ztna_
    complexed with nag

Details for d6v49c1

PDB Entry: 6v49 (more details), 2.5 Å

PDB Description: the crystal structure of hemagglutinin from a/wedge-tailed shearwater/western australia/2576/1979 (h15n9)
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6v49c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v49c1 b.19.1.0 (C:1-328) automated matches {Influenza a virus (a/wedge-tailed shearwater/western australia/2576/1979(h15n9)) [TaxId: 352560]}
dkiclghhavangtkvntltergvevvnatetveitgidkvctkgkkavdlgscgilgti
igppqcdlhlefkadliierrnssdicypgrftneealrqiiresggidkesmgfrysgi
rtdgatsackrssssfysemkwlsssmnnqvfpqlnqtyrntrkepalivwgvhhsssld
eqnklygtgnklitvgsskyqqsfspspgarpkvngqagridfhwmlldpgdtvtftfng
afiapdratflrsnapsgieyngkslgiqsdaqidescegecfysggtinsplpfqnids
ravgkcpryvkqsslplalgmknvpeki

SCOPe Domain Coordinates for d6v49c1:

Click to download the PDB-style file with coordinates for d6v49c1.
(The format of our PDB-style files is described here.)

Timeline for d6v49c1: