Lineage for d6v06a3 (6v06 A:121-183)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638750Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2638751Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2639036Family g.18.1.0: automated matches [254264] (1 protein)
    not a true family
  6. 2639037Protein automated matches [254611] (1 species)
    not a true protein
  7. 2639038Species Human (Homo sapiens) [TaxId:9606] [255500] (7 PDB entries)
  8. 2639046Domain d6v06a3: 6v06 A:121-183 [387886]
    automated match to d1quba3
    complexed with bma, epe, man, nag, so4

Details for d6v06a3

PDB Entry: 6v06 (more details), 2.4 Å

PDB Description: crystal structure of beta-2 glycoprotein i purified from plasma (pb2gpi)
PDB Compounds: (A:) Beta-2-glycoprotein 1

SCOPe Domain Sequences for d6v06a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v06a3 g.18.1.0 (A:121-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iicpppsiptfatlrvykpsagnnslyrdtavfeclpqhamfgndtitctthgnwtklpe
cre

SCOPe Domain Coordinates for d6v06a3:

Click to download the PDB-style file with coordinates for d6v06a3.
(The format of our PDB-style files is described here.)

Timeline for d6v06a3: