Class g: Small proteins [56992] (98 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.0: automated matches [254264] (1 protein) not a true family |
Protein automated matches [254611] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255500] (7 PDB entries) |
Domain d6v06a3: 6v06 A:121-183 [387886] automated match to d1quba3 complexed with bma, epe, man, nag, so4 |
PDB Entry: 6v06 (more details), 2.4 Å
SCOPe Domain Sequences for d6v06a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v06a3 g.18.1.0 (A:121-183) automated matches {Human (Homo sapiens) [TaxId: 9606]} iicpppsiptfatlrvykpsagnnslyrdtavfeclpqhamfgndtitctthgnwtklpe cre
Timeline for d6v06a3:
View in 3D Domains from same chain: (mouse over for more information) d6v06a1, d6v06a2, d6v06a4, d6v06a5 |