SCOPe 2.07: Domain d6prda1: 6prd A:1-158

Lineage for d6prda1 (6prd A:1-158)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Staphylococcus aureus [TaxId:1280] [188976] (32 PDB entries)

8. Domain d6prda1: 6prd A:1-158 [387809]
   Other proteins in same PDB: d6prda2
   automated match to d3fywx_
   complexed with gol, nap, owg

Details for d6prda1

PDB Entry: 6prd, 2.01 Å

PDB Description: s. aureus dihydrofolate reductase co-crystallized with para- methoxyphenyl-dimethyoxydihydropthalazine inhibitor and nadp(h)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d6prda1:

Sequence; same for both SEQRES and ATOM records:

>d6prda1 c.71.1.1 (A:1-158) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirkk

Timeline for d6prda1:

• d6prda1 is new in SCOPe 2.07-stable
  
• d6prda1 appears in the current release, SCOPe 2.08