Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein automated matches [190658] (12 species) not a true protein |
Species Zika virus [TaxId:64320] [327129] (7 PDB entries) |
Domain d6kk3b_: 6kk3 B: [387752] Other proteins in same PDB: d6kk3a_ automated match to d5gpih_ complexed with duu |
PDB Entry: 6kk3 (more details), 2.05 Å
SCOPe Domain Sequences for d6kk3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kk3b_ b.47.1.3 (B:) automated matches {Zika virus [TaxId: 64320]} ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg spildkcgrviglygngvvikngsyvsaitqgkr
Timeline for d6kk3b_: