SCOPe 2.07: Domain d6kk2b_: 6kk2 B:

Lineage for d6kk2b_ (6kk2 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Zika virus (strain mr 766) [TaxId:64320] [324405] (8 PDB entries)

8. Domain d6kk2b_: 6kk2 B: [387727]
   Other proteins in same PDB: d6kk2a_
   automated match to d3e90b_
   complexed with d9u

Details for d6kk2b_

PDB Entry: 6kk2, 2.02 Å

PDB Description: crystal structure of zika ns2b-ns3 protease with compound 2

PDB Compounds: (B:) NS3 protease

SCOPe Domain Sequences for d6kk2b_:

Sequence; same for both SEQRES and ATOM records:

>d6kk2b_ b.47.1.3 (B:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl
vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg
spildkcgrviglygngvvikngsyvsaitqgkre

Timeline for d6kk2b_:

• d6kk2b_ is new in SCOPe 2.07-stable
  
• d6kk2b_ appears in the current release, SCOPe 2.08