SCOPe 2.07: Domain d6yt2b2: 6yt2 B:290-401

Lineage for d6yt2b2 (6yt2 B:290-401)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69674] (46 PDB entries)

8. Domain d6yt2b2: 6yt2 B:290-401 [387661]
   Other proteins in same PDB: d6yt2a1, d6yt2b1
   automated match to d2xfua2
   complexed with c15, fad, gol, pjw

Details for d6yt2b2

PDB Entry: 6yt2, 1.8 Å

PDB Description: crystal structure of human monoamine oxidase b in complex with diphenylene iodonium (dpi)

PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d6yt2b2:

Sequence; same for both SEQRES and ATOM records:

>d6yt2b2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

Timeline for d6yt2b2:

• d6yt2b2 is new in SCOPe 2.07-stable
  
• d6yt2b2 appears in the current release, SCOPe 2.08