Lineage for d5rhua2 (5rhu A:482-617)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2481166Species Zika virus [TaxId:64320] [317810] (28 PDB entries)
  8. 2481180Domain d5rhua2: 5rhu A:482-617 [387563]
    Other proteins in same PDB: d5rhua1
    automated match to d5y4za2
    complexed with edo, mpd, po4, ur7

Details for d5rhua2

PDB Entry: 5rhu (more details), 1.61 Å

PDB Description: pandda analysis group deposition -- crystal structure of zika virus ns3 helicase in complex with z1703168683
PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5rhua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rhua2 c.37.1.0 (A:482-617) automated matches {Zika virus [TaxId: 64320]}
eghahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtkygekrvlkprwmdarvcs
dhaalksfkefaagkr

SCOPe Domain Coordinates for d5rhua2:

Click to download the PDB-style file with coordinates for d5rhua2.
(The format of our PDB-style files is described here.)

Timeline for d5rhua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5rhua1