Lineage for d1qnnb2 (1qnn B:85-191)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2552895Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2552896Protein Cambialistic superoxide dismutase [54732] (2 species)
    active with either fe or mn
  7. 2552897Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries)
    Uniprot P19665
  8. 2552907Domain d1qnnb2: 1qnn B:85-191 [38756]
    Other proteins in same PDB: d1qnna1, d1qnnb1, d1qnnc1, d1qnnd1
    complexed with fe

Details for d1qnnb2

PDB Entry: 1qnn (more details), 1.8 Å

PDB Description: cambialistic superoxide dismutase from porphyromonas gingivalis
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1qnnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnnb2 d.44.1.1 (B:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn
pvrkglnpllgfdvwehayyltyqnrradhlkdlwsivdwdivesry

SCOPe Domain Coordinates for d1qnnb2:

Click to download the PDB-style file with coordinates for d1qnnb2.
(The format of our PDB-style files is described here.)

Timeline for d1qnnb2: