Lineage for d5qz2b2 (5qz2 B:170-317)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340660Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family) (S)
    C-terminal part of Pfam PF05282
    Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology
  5. 2340661Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 proteins)
  6. 2340662Protein U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain [346042] (1 species)
  7. 2340663Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346205] (140 PDB entries)
  8. 2340695Domain d5qz2b2: 5qz2 B:170-317 [387523]
    Other proteins in same PDB: d5qz2a1, d5qz2a2, d5qz2b1
    automated match to d3sbtb2

Details for d5qz2b2

PDB Entry: 5qz2 (more details), 1.54 Å

PDB Description: pandda analysis group deposition -- auto-refined data of aar2/rnaseh for ground state model 17
PDB Compounds: (B:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d5qz2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qz2b2 a.118.29.1 (B:170-317) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sdpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfafl
namffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervw
niclyssfqknslhntekimenkypell

SCOPe Domain Coordinates for d5qz2b2:

Click to download the PDB-style file with coordinates for d5qz2b2.
(The format of our PDB-style files is described here.)

Timeline for d5qz2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5qz2b1