Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (4 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein automated matches [226986] (8 species) not a true protein |
Species Zika virus [TaxId:64320] [317808] (28 PDB entries) |
Domain d5rhla1: 5rhl A:183-481 [387483] Other proteins in same PDB: d5rhla2 automated match to d5jpsa1 complexed with edo, h04, mpd, po4 |
PDB Entry: 5rhl (more details), 1.43 Å
SCOPe Domain Sequences for d5rhla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5rhla1 c.37.1.14 (A:183-481) automated matches {Zika virus [TaxId: 64320]} mlkkkqltvldlhpgagktrrvlpeivreaikkrlrtvilaptrvvaaemeealrglpvr ymttavnvthsgteivdlmchatftsrllqpirvpnynlnimdeahftdpssiaargyis trvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwf vpsvrngneiaacltkagkrviqlsrktfetefqktknqewdfvittdisemganfkadr vidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeymygggcaetd
Timeline for d5rhla1: