Lineage for d6k79b2 (6k79 B:248-491)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493455Species Thermococcus kodakarensis [TaxId:69014] [225454] (4 PDB entries)
  8. 2493463Domain d6k79b2: 6k79 B:248-491 [387286]
    automated match to d2zf5o2
    complexed with gol, pge

Details for d6k79b2

PDB Entry: 6k79 (more details), 2.19 Å

PDB Description: glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
PDB Compounds: (B:) glycerol kinase

SCOPe Domain Sequences for d6k79b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k79b2 c.55.1.0 (B:248-491) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
aafeagmvkatygtgsfilvntdemvlysdnllttiawglngrvsyalegsifvtgaavq
wlrdgikiikhaseteelatklesnegvyfvpafvglgapywdqfargiiigitrgtgre
hlaratleaiayltrdvvdemeklvqikelrvdggatandflmqfqadilnrkvirpvvk
ettalgaaylaglavdywadtreiaelwkaerifepkmdektrerlykgwkeavkramgw
akvv

SCOPe Domain Coordinates for d6k79b2:

Click to download the PDB-style file with coordinates for d6k79b2.
(The format of our PDB-style files is described here.)

Timeline for d6k79b2: