Lineage for d1isab2 (1isa B:83-192)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859482Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 859483Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 859484Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 859512Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 859561Species Escherichia coli [TaxId:562] [54727] (6 PDB entries)
  8. 859573Domain d1isab2: 1isa B:83-192 [38725]
    Other proteins in same PDB: d1isaa1, d1isab1
    complexed with fe2; mutant

Details for d1isab2

PDB Entry: 1isa (more details), 1.8 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
PDB Compounds: (B:) iron(II) superoxide dismutase

SCOP Domain Sequences for d1isab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isab2 d.44.1.1 (B:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

SCOP Domain Coordinates for d1isab2:

Click to download the PDB-style file with coordinates for d1isab2.
(The format of our PDB-style files is described here.)

Timeline for d1isab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1isab1