Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Thermococcus kodakarensis [TaxId:69014] [225454] (4 PDB entries) |
Domain d6k76a1: 6k76 A:5-247 [387233] automated match to d2zf5o1 complexed with anp |
PDB Entry: 6k76 (more details), 3.05 Å
SCOPe Domain Sequences for d6k76a1:
Sequence, based on SEQRES records: (download)
>d6k76a1 c.55.1.0 (A:5-247) automated matches {Thermococcus kodakarensis [TaxId: 69014]} vlsldegttsaraiifdresnihgigqyefpqhyprpgwvehnpeeiwdaqlraikdaiq sariepnqiaaigvtnqrettlvwdkdgkplynaivwqcrrtaemveeikreygtmikek tglvpdayfsasklkwlldnvpglrekaekgevmfgtvdtfliyrltgehvtdysnasrt mlfnikkldwddellelfdipesvlpevressevygytkkellgaeipvsgdagdqqaal fgq
>d6k76a1 c.55.1.0 (A:5-247) automated matches {Thermococcus kodakarensis [TaxId: 69014]} vlsldegttsaraiifdresnihgigqyefpqhyprpgwvehnpeeiwdaqlraikdaiq sarepnqiaaigvtnqrettlvwdkdgkplynaivwqcrrtaemveeikreygtmikekt glvpdayfsasklkwlldnvpglrekaekgevmfgtvdtfliyrltgehvtdysnasrtm lfnikkldwddellelfdipesvlpevressevygytkkelaeipvsgdagdqqaalfgq
Timeline for d6k76a1: