Lineage for d6lueb1 (6lue B:1-205)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470051Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2470052Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2470089Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 2470090Protein automated matches [227113] (4 species)
    not a true protein
  7. 2470105Species Mouse (Mus musculus) [TaxId:10090] [226619] (17 PDB entries)
  8. 2470125Domain d6lueb1: 6lue B:1-205 [387147]
    Other proteins in same PDB: d6luea2, d6lueb2, d6lueb3
    automated match to d4mlpa1
    complexed with eul

Details for d6lueb1

PDB Entry: 6lue (more details), 2.1 Å

PDB Description: crystal structure of mouse cryptochrome 1 in complex with compound kl201
PDB Compounds: (B:) Cryptochrome-1

SCOPe Domain Sequences for d6lueb1:

Sequence, based on SEQRES records: (download)

>d6lueb1 c.28.1.0 (B:1-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mgvnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcle
dldanlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklatea
gvevivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmt
plsddhdekygvpsleelgfdtdgl

Sequence, based on observed residues (ATOM records): (download)

>d6lueb1 c.28.1.0 (B:1-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mgvnavhwfrkglrlhdnpalkeciqgadtircvyildpnvginrwrfllqcledldanl
rklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagveviv
rishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtplsddh
dekygvpsleelgfdtdgl

SCOPe Domain Coordinates for d6lueb1:

Click to download the PDB-style file with coordinates for d6lueb1.
(The format of our PDB-style files is described here.)

Timeline for d6lueb1: