Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) automatically mapped to Pfam PF00875 |
Family c.28.1.0: automated matches [227292] (1 protein) not a true family |
Protein automated matches [227113] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [226619] (17 PDB entries) |
Domain d6lueb1: 6lue B:1-205 [387147] Other proteins in same PDB: d6luea2, d6lueb2, d6lueb3 automated match to d4mlpa1 complexed with eul |
PDB Entry: 6lue (more details), 2.1 Å
SCOPe Domain Sequences for d6lueb1:
Sequence, based on SEQRES records: (download)
>d6lueb1 c.28.1.0 (B:1-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mgvnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcle dldanlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklatea gvevivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmt plsddhdekygvpsleelgfdtdgl
>d6lueb1 c.28.1.0 (B:1-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mgvnavhwfrkglrlhdnpalkeciqgadtircvyildpnvginrwrfllqcledldanl rklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagveviv rishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtplsddh dekygvpsleelgfdtdgl
Timeline for d6lueb1: