Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (70 species) not a true protein |
Species Chlamydia trachomatis [TaxId:813] [387010] (1 PDB entry) |
Domain d6x60d_: 6x60 D: [387069] automated match to d5e0se_ |
PDB Entry: 6x60 (more details), 2.81 Å
SCOPe Domain Sequences for d6x60d_:
Sequence, based on SEQRES records: (download)
>d6x60d_ c.14.1.0 (D:) automated matches {Chlamydia trachomatis [TaxId: 813]} tlvpyvvedtgrgeramdiysrllkdrivmigqeiteplantviaqllflmsedptkdiq ifinspggyitaglaiydtirflgcdvntycigqaasmgalllsagtkgkryalphsrmm ihqpsggiigtsadiqlqaaeiltlkkhlsnilaectgqsvekiiedserdffmgaeeai ayglidkvissaket
>d6x60d_ c.14.1.0 (D:) automated matches {Chlamydia trachomatis [TaxId: 813]} tlvpyvvamdiysrllkdrivmigqeiteplantviaqllflmsedptkdiqifinspgg yitaglaiydtirflgcdvntycigqaasmgalllsagtkgkryalphsrmmihqpsggi igtsadiqlqaaeiltlkkhlsnilaectgqsvekiiedserdffmgaeeaiayglidkv issaket
Timeline for d6x60d_: