Lineage for d6ymdb_ (6ymd B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503664Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2504021Protein automated matches [190152] (25 species)
    not a true protein
  7. 2504024Species Aphanothece halophytica [TaxId:72020] [387036] (3 PDB entries)
  8. 2504026Domain d6ymdb_: 6ymd B: [387037]
    automated match to d3pgya_
    complexed with edo, mli, na, pmp

Details for d6ymdb_

PDB Entry: 6ymd (more details), 1.25 Å

PDB Description: crystal structure of serine hydroxymethyltransferase from aphanothece halophytica in the covalent complex with malonate
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d6ymdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ymdb_ c.67.1.4 (B:) automated matches {Aphanothece halophytica [TaxId: 72020]}
qtnldfllqtdptisgmmqkelqrqrehleliasenftspavmatqgsvltnkyaeglpk
kryyggcefideieqvaidrakelfgaasanvqphsgaqanfavfltllkpgdkimgmdl
shgghlthgspanvsgkwfeavhygvsqeteqldydhilevarqerpkliicgysaypri
infekfraiadevgaylladiahiaglvasghhpnpvphcdvvtttthktlrgprgglil
trdpelgkkfnksvfpgtqggplehviagkavafgealkpefkaysgqvianaqamaqql
qnrgfkivsggtdnhlmlvdlrsvnltgkqadqlvsdvnitankntvpfdpespfvtsgl
rlgspamttrglgtedfaeianiiadrlqnpedeqvkqacvqrvaalcerfplyphlna

SCOPe Domain Coordinates for d6ymdb_:

Click to download the PDB-style file with coordinates for d6ymdb_.
(The format of our PDB-style files is described here.)

Timeline for d6ymdb_: