SCOPe 2.07: Domain d6x4ib2: 6x4i B:192-346

Lineage for d6x4ib2 (6x4i B:192-346)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.0: automated matches [356574] (1 protein)
   not a true family

6. Protein automated matches [356575] (3 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382219] (6 PDB entries)

8. Domain d6x4ib2: 6x4i B:192-346 [387015]
   Other proteins in same PDB: d6x4ia1, d6x4ia3, d6x4ib1, d6x4ib3
   automated match to d2h85a2
   complexed with edo, na, u3p

Details for d6x4ib2

PDB Entry: 6x4i, 1.85 Å

PDB Description: crystal structure of nsp15 endoribonuclease from sars cov-2 in the complex with 3'-uridinemonophosphate

PDB Compounds: (B:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d6x4ib2:

Sequence; same for both SEQRES and ATOM records:

>d6x4ib2 d.294.1.0 (B:192-346) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl
liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsvvskvvkvtidyteisfmlwckdghvetfypkl

Timeline for d6x4ib2:

• d6x4ib2 is new in SCOPe 2.07-stable
  
• d6x4ib2 appears in the current release, SCOPe 2.08