Lineage for d6ro9a_ (6ro9 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392869Protein automated matches [190043] (8 species)
    not a true protein
  7. 2392960Species Mola mola [TaxId:94237] [386993] (1 PDB entry)
  8. 2392961Domain d6ro9a_: 6ro9 A: [386994]
    automated match to d2f2va_

Details for d6ro9a_

PDB Entry: 6ro9 (more details), 1.81 Å

PDB Description: human spectrin sh3 domain d48g, e7v, k60v
PDB Compounds: (A:) Spectrin alpha, non-erythrocytic 1

SCOPe Domain Sequences for d6ro9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ro9a_ b.34.2.1 (A:) automated matches {Mola mola [TaxId: 94237]}
kvlvlalydyqeksprevtmkkgdiltllnstnkdwwkvevngrqgfvpaayvkvl

SCOPe Domain Coordinates for d6ro9a_:

Click to download the PDB-style file with coordinates for d6ro9a_.
(The format of our PDB-style files is described here.)

Timeline for d6ro9a_: