Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries) |
Domain d1fqvf2: 1fqv F:2-68 [38668] Other proteins in same PDB: d1fqva1, d1fqva2, d1fqvb1, d1fqvc1, d1fqvc2, d1fqvd1, d1fqve1, d1fqve2, d1fqvf1, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvo1, d1fqvo2, d1fqvp1 |
PDB Entry: 1fqv (more details), 2.8 Å
SCOPe Domain Sequences for d1fqvf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqvf2 d.42.1.1 (F:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd d
Timeline for d1fqvf2:
View in 3D Domains from other chains: (mouse over for more information) d1fqva1, d1fqva2, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve1, d1fqve2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp1, d1fqvp2 |