SCOPe 2.08: Domain d1fqvb2: 1fqv B:2-68

Lineage for d1fqvb2 (1fqv B:2-68)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries)

8. Domain d1fqvb2: 1fqv B:2-68 [38666]
   Other proteins in same PDB: d1fqva1, d1fqva2, d1fqvb1, d1fqvc1, d1fqvc2, d1fqvd1, d1fqve1, d1fqve2, d1fqvf1, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvo1, d1fqvo2, d1fqvp1
   missing some secondary structures that made up less than one-third of the common domain

Details for d1fqvb2

PDB Entry: 1fqv, 2.8 Å

PDB Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

PDB Compounds: (B:) skp1

SCOPe Domain Sequences for d1fqvb2:

Sequence; same for both SEQRES and ATOM records:

>d1fqvb2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d

Timeline for d1fqvb2:

• d1fqvb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fqvb2 appears in SCOPe 2.07