![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) |
![]() | Superfamily d.42.1: POZ domain [54695] (2 families) ![]() |
![]() | Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins) |
![]() | Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54711] (3 PDB entries) |
![]() | Domain d1fs1b2: 1fs1 B:2-68 [38664] Other proteins in same PDB: d1fs1a1, d1fs1b1, d1fs1c1, d1fs1d1 |
PDB Entry: 1fs1 (more details), 1.8 Å
SCOP Domain Sequences for d1fs1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs1b2 d.42.1.2 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)} psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd d
Timeline for d1fs1b2:
![]() Domains from other chains: (mouse over for more information) d1fs1a1, d1fs1c1, d1fs1d1, d1fs1d2 |