Lineage for d1fs1b2 (1fs1 B:2-68)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31889Fold d.42: POZ domain [54694] (1 superfamily)
  4. 31890Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 31902Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)
  6. 31906Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
  7. 31907Species Human (Homo sapiens) [TaxId:9606] [54711] (3 PDB entries)
  8. 31908Domain d1fs1b2: 1fs1 B:2-68 [38664]
    Other proteins in same PDB: d1fs1a1, d1fs1b1, d1fs1c1, d1fs1d1

Details for d1fs1b2

PDB Entry: 1fs1 (more details), 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs1b2 d.42.1.2 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d

SCOP Domain Coordinates for d1fs1b2:

Click to download the PDB-style file with coordinates for d1fs1b2.
(The format of our PDB-style files is described here.)

Timeline for d1fs1b2:

31908
d1fs1b2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fs1b1