Lineage for d6jz1b2 (6jz1 B:186-278)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373276Species [ruminococcus] gnavus [TaxId:33038] [361225] (3 PDB entries)
  8. 2373280Domain d6jz1b2: 6jz1 B:186-278 [386585]
    Other proteins in same PDB: d6jz1a1, d6jz1a3, d6jz1b1, d6jz1b3
    automated match to d5c71a2
    complexed with mrd

Details for d6jz1b2

PDB Entry: 6jz1 (more details), 1.73 Å

PDB Description: apo structure of b-glucuronidase from ruminococcus gnavus at 1.7 angstrom resolution
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6jz1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jz1b2 b.1.4.0 (B:186-278) automated matches {[ruminococcus] gnavus [TaxId: 33038]}
esvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqvanarl
wevrnaylyqivilitdgngvldeyrekigirt

SCOPe Domain Coordinates for d6jz1b2:

Click to download the PDB-style file with coordinates for d6jz1b2.
(The format of our PDB-style files is described here.)

Timeline for d6jz1b2: