Class b: All beta proteins [48724] (178 folds) |
Fold b.182: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345889] (1 superfamily) 10-stranded mixed beta sandwich with 3 helices surrounding the upper rim |
Superfamily b.182.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345922] (1 family) N-terminal part of Pfam PF05282 |
Family b.182.1.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345967] (2 proteins) |
Protein U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain [346065] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346269] (140 PDB entries) |
Domain d5r0eb1: 5r0e B:1-152 [386490] Other proteins in same PDB: d5r0ea1, d5r0ea2, d5r0eb2 automated match to d3sbtb1 complexed with sy4 |
PDB Entry: 5r0e (more details), 1.59 Å
SCOPe Domain Sequences for d5r0eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5r0eb1 b.182.1.1 (B:1-152) U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef vqmdkirkivrkdenqfsyvdssmttvqenel
Timeline for d5r0eb1: