Lineage for d5r0eb1 (5r0e B:1-152)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434545Fold b.182: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345889] (1 superfamily)
    10-stranded mixed beta sandwich with 3 helices surrounding the upper rim
  4. 2434546Superfamily b.182.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345922] (1 family) (S)
    N-terminal part of Pfam PF05282
  5. 2434547Family b.182.1.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345967] (2 proteins)
  6. 2434548Protein U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain [346065] (1 species)
  7. 2434549Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346269] (140 PDB entries)
  8. 2434604Domain d5r0eb1: 5r0e B:1-152 [386490]
    Other proteins in same PDB: d5r0ea1, d5r0ea2, d5r0eb2
    automated match to d3sbtb1
    complexed with sy4

Details for d5r0eb1

PDB Entry: 5r0e (more details), 1.59 Å

PDB Description: pandda analysis group deposition -- aar2/rnaseh in complex with fragment f2x-entry d02, dmso-free
PDB Compounds: (B:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d5r0eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5r0eb1 b.182.1.1 (B:1-152) U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
vqmdkirkivrkdenqfsyvdssmttvqenel

SCOPe Domain Coordinates for d5r0eb1:

Click to download the PDB-style file with coordinates for d5r0eb1.
(The format of our PDB-style files is described here.)

Timeline for d5r0eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5r0eb2