Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein automated matches [190264] (12 species) not a true protein |
Species Leishmania mexicana [TaxId:5665] [386469] (1 PDB entry) |
Domain d6p4ea_: 6p4e A: [386470] automated match to d3i06a_ complexed with act, ges, mpd, na, trs |
PDB Entry: 6p4e (more details), 1.35 Å
SCOPe Domain Sequences for d6p4ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p4ea_ d.3.1.1 (A:) automated matches {Leishmania mexicana [TaxId: 5665]} vpdavdwrekgavtpvkdqgacgscwafsavgniegqwylaghelvslseqqlvscddmd ngcsgglmlqafdwllqntnghlhtedsypyvsgngyvpecsnsselvvgaqidghvlig ssekamaawlakngpiaialdassfmsyksgvltacigkqlnhgvllvgydmtgevpywv iknswggdwgeqgyvrvvmgvnacllseypvsahvr
Timeline for d6p4ea_: