SCOPe 2.07: Domain d6p4ea_: 6p4e A:

Lineage for d6p4ea_ (6p4e A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (12 species)
   not a true protein

7. Species Leishmania mexicana [TaxId:5665] [386469] (1 PDB entry)

8. Domain d6p4ea_: 6p4e A: [386470]
   automated match to d3i06a_
   complexed with act, ges, mpd, na, trs

Details for d6p4ea_

PDB Entry: 6p4e, 1.35 Å

PDB Description: leishmania mexicana cpb in complex with an aza-nitrile inhibitor

PDB Compounds: (A:) Cysteine proteinase B

SCOPe Domain Sequences for d6p4ea_:

Sequence; same for both SEQRES and ATOM records:

>d6p4ea_ d.3.1.1 (A:) automated matches {Leishmania mexicana [TaxId: 5665]}
vpdavdwrekgavtpvkdqgacgscwafsavgniegqwylaghelvslseqqlvscddmd
ngcsgglmlqafdwllqntnghlhtedsypyvsgngyvpecsnsselvvgaqidghvlig
ssekamaawlakngpiaialdassfmsyksgvltacigkqlnhgvllvgydmtgevpywv
iknswggdwgeqgyvrvvmgvnacllseypvsahvr

Timeline for d6p4ea_:

• d6p4ea_ is new in SCOPe 2.07-stable
  
• d6p4ea_ appears in the current release, SCOPe 2.08