Lineage for d6k6ia_ (6k6i A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628564Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2628565Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2628891Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 2628892Protein automated matches [226845] (23 species)
    not a true protein
  7. 2628951Species Mastigocladopsis repens [TaxId:221287] [382092] (6 PDB entries)
  8. 2628954Domain d6k6ia_: 6k6i A: [386455]
    automated match to d4hyxb_
    complexed with cl, ola, ret

Details for d6k6ia_

PDB Entry: 6k6i (more details), 1.9 Å

PDB Description: the crystal structure of light-driven cyanobacterial chloride importer from mastigocladopsis repens
PDB Compounds: (A:) Cyanobacterial chloride importer

SCOPe Domain Sequences for d6k6ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k6ia_ f.13.1.0 (A:) automated matches {Mastigocladopsis repens [TaxId: 221287]}
mtqawlwigvismalgsvffgfgahnaknerwqilytlnfficliaaglylamalglgvn
vingrptywvrfvtwfcstplllldltflgrtslpltgsllganaymlvtgfvatvtpkp
msyiwyivscaaylaivyllaqpyriaaerkhprskqafrtlvtvhlvlwtlypivwils
pegfstftqgsetmfytlldiaskvgfgflslntlhtle

SCOPe Domain Coordinates for d6k6ia_:

Click to download the PDB-style file with coordinates for d6k6ia_.
(The format of our PDB-style files is described here.)

Timeline for d6k6ia_: