Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.0: automated matches [227143] (1 protein) not a true family |
Protein automated matches [226845] (23 species) not a true protein |
Species Mastigocladopsis repens [TaxId:221287] [382092] (6 PDB entries) |
Domain d6k6ia_: 6k6i A: [386455] automated match to d4hyxb_ complexed with cl, ola, ret |
PDB Entry: 6k6i (more details), 1.9 Å
SCOPe Domain Sequences for d6k6ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k6ia_ f.13.1.0 (A:) automated matches {Mastigocladopsis repens [TaxId: 221287]} mtqawlwigvismalgsvffgfgahnaknerwqilytlnfficliaaglylamalglgvn vingrptywvrfvtwfcstplllldltflgrtslpltgsllganaymlvtgfvatvtpkp msyiwyivscaaylaivyllaqpyriaaerkhprskqafrtlvtvhlvlwtlypivwils pegfstftqgsetmfytlldiaskvgfgflslntlhtle
Timeline for d6k6ia_: