SCOPe 2.07: Domain d1exbe_: 1exb E:

Lineage for d1exbe_ (1exb E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)

6. Protein KV1.1 [54706] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [54707] (1 PDB entry)

8. Domain d1exbe_: 1exb E: [38643]
   Other proteins in same PDB: d1exba_
   complexed with ndp

Details for d1exbe_

PDB Entry: 1exb, 2.1 Å

PDB Description: structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels

PDB Compounds: (E:) potassium channel kv1.1

SCOPe Domain Sequences for d1exbe_:

Sequence; same for both SEQRES and ATOM records:

>d1exbe_ d.42.1.2 (E:) KV1.1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cervvinisglrfetqlktlaqfpntllgnpkkrmryfdplrneyffdrnrpsfdailyy
yqsggrlrrpvnvpldmfseeikfyelgeea

Timeline for d1exbe_:

• d1exbe_ first appeared (with stable ids) in SCOP 1.55
  
• d1exbe_ appears in SCOPe 2.06
  
• d1exbe_ appears in the current release, SCOPe 2.08