Lineage for d6wpsf_ (6wps F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369142Domain d6wpsf_: 6wps F: [386420]
    automated match to d4odxa_
    complexed with bma, fuc, man, nag

Details for d6wpsf_

PDB Entry: 6wps (more details), 3.1 Å

PDB Description: structure of the sars-cov-2 spike glycoprotein in complex with the s309 neutralizing antibody fab fragment
PDB Compounds: (F:) S309 neutralizing antibody heavy chain

SCOPe Domain Sequences for d6wpsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wpsf_ b.1.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkkpgasvkvsckasgypftsygiswvrqapgqglewmgwistyngntnya
qkfqgrvtmttdtstttgymelrrlrsddtavyycardytrgawfgesliggfdnwgqgt
lvt

SCOPe Domain Coordinates for d6wpsf_:

Click to download the PDB-style file with coordinates for d6wpsf_.
(The format of our PDB-style files is described here.)

Timeline for d6wpsf_: