Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [311257] (2 PDB entries) |
Domain d6v6ya2: 6v6y A:119-277 [386374] Other proteins in same PDB: d6v6ya1 automated match to d1b0aa1 complexed with nap |
PDB Entry: 6v6y (more details), 2.15 Å
SCOPe Domain Sequences for d6v6ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v6ya2 c.2.1.0 (A:119-277) automated matches {Thermus thermophilus [TaxId: 300852]} fhplnvgrlwsggkglfpctplgvvrllkhygvdlrgkevvvvgrsnivgkplaglllre datvtlahsktqdlpevtrraqvlvvavgrphlvrkewvregaivvdvgvnrvegrllgd vhpevaevafaltpvpggvgpmtvamlmgntleaallrr
Timeline for d6v6ya2: