Lineage for d6v6ya2 (6v6y A:119-277)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2457266Species Thermus thermophilus [TaxId:300852] [311257] (2 PDB entries)
  8. 2457267Domain d6v6ya2: 6v6y A:119-277 [386374]
    Other proteins in same PDB: d6v6ya1
    automated match to d1b0aa1
    complexed with nap

Details for d6v6ya2

PDB Entry: 6v6y (more details), 2.15 Å

PDB Description: crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd)
PDB Compounds: (A:) Bifunctional protein folD

SCOPe Domain Sequences for d6v6ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v6ya2 c.2.1.0 (A:119-277) automated matches {Thermus thermophilus [TaxId: 300852]}
fhplnvgrlwsggkglfpctplgvvrllkhygvdlrgkevvvvgrsnivgkplaglllre
datvtlahsktqdlpevtrraqvlvvavgrphlvrkewvregaivvdvgvnrvegrllgd
vhpevaevafaltpvpggvgpmtvamlmgntleaallrr

SCOPe Domain Coordinates for d6v6ya2:

Click to download the PDB-style file with coordinates for d6v6ya2.
(The format of our PDB-style files is described here.)

Timeline for d6v6ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6v6ya1