SCOPe 2.07: Domain d6to0a1: 6to0 A:6-380

Lineage for d6to0a1 (6to0 A:6-380)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)

6. Protein automated matches [196672] (8 species)
   not a true protein

7. Species Paenibacillus barcinonensis [TaxId:198119] [386243] (7 PDB entries)

8. Domain d6to0a1: 6to0 A:6-380 [386317]
   Other proteins in same PDB: d6to0a2, d6to0b2
   automated match to d2drsa_
   complexed with ahr, gol, xyp; mutant

Details for d6to0a1

PDB Entry: 6to0, 1.88 Å

PDB Description: structure of e70a mutant of rex8a from paenibacillus barcinonensis complexed with 2(3)-alpha-l-arabinofuranosyl-xylotriose.

PDB Compounds: (A:) Reducing-end xylose-releasing exo-oligoxylanase Rex8A

SCOPe Domain Sequences for d6to0a1:

Sequence; same for both SEQRES and ATOM records:

>d6to0a1 a.102.1.2 (A:6-380) automated matches {Paenibacillus barcinonensis [TaxId: 198119]}
kgaydtgtyanlfqrsgyredeikarleqtwndlfygdehtriyypvgddkgymldtgnd
dvrsagmsygmmmavqmdkkhefdrlwnyaytymqhtegrykdyfawhckpdgtrlspgp
apdgeeffamalffasnrwgdgpapydyqaqarkilhaclhqgeqgegdpmwepsnrlik
fipelpfsdpsyhlphfyelfaqyaneqdrtfwkeaaeasraylrtachpvtglspeyan
ydgtpapvqlhgdfrhfysdayrvaanvaldwewfrkdpwqvqqsnriqaffsdidvsdy
rrytiegepfnepalhpvgllatnamaslaadgpdadsfvkrfwntplrqgkrryydncl
yfftmlalsgnyrvy

Timeline for d6to0a1:

• d6to0a1 is new in SCOPe 2.07-stable
  
• d6to0a1 appears in the current release, SCOPe 2.08