Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Photorhabdus luminescens [TaxId:243265] [386265] (2 PDB entries) |
Domain d6smph1: 6smp H:2-265 [386266] automated match to d1tqya1 complexed with lle |
PDB Entry: 6smp (more details), 2.9 Å
SCOPe Domain Sequences for d6smph1:
Sequence, based on SEQRES records: (download)
>d6smph1 c.95.1.0 (H:2-265) automated matches {Photorhabdus luminescens [TaxId: 243265]} iinnrnesqprrvvvtglgvvaptgvgvnefwnnihngksgvskyewgrerfgfksgaig qvygsdgnnkefvlkserkylqfaldaaemamqdanlrpsdidgrrfgvaiataiadaag meecllritkggkenihpdliksedydsfdfssaatsvakkygasmsvsnistgcaagld algiamehirygradimlagaseaplcplsigsfealgalssrelenqqaatcpfslerd gfviaegcgililesyehakqrga
>d6smph1 c.95.1.0 (H:2-265) automated matches {Photorhabdus luminescens [TaxId: 243265]} iinnrnesqprrvvvtglgvvaptgvgvnefwnnihngksgvskyewgrerfgfksgaig qvyerkylqfaldaaemamqdanlrpsdidgrrfgvaiataiadaagmeecllritkggk enihpdliksedydsfdfssaatsvakkygasmsvsnistgcaagldalgiamehirygr adimlagaseaplcplsigsfealgalssrelenqqaatcpfslerdgfviaegcgilil esyehakqrga
Timeline for d6smph1:
View in 3D Domains from other chains: (mouse over for more information) d6smpb1, d6smpb2, d6smpe1, d6smpe2 |