Lineage for d6pcbd1 (6pcb D:1-275)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525407Species Pseudomonas putida [TaxId:160488] [386171] (4 PDB entries)
  8. 2525422Domain d6pcbd1: 6pcb D:1-275 [386220]
    Other proteins in same PDB: d6pcba3, d6pcbb3, d6pcbc3, d6pcbd3
    automated match to d3ss6a1
    complexed with cl, coa, cso, gol; mutant

Details for d6pcbd1

PDB Entry: 6pcb (more details), 1.61 Å

PDB Description: crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex with coa
PDB Compounds: (D:) Beta-ketoadipyl-CoA thiolase

SCOPe Domain Sequences for d6pcbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pcbd1 c.95.1.0 (D:1-275) automated matches {Pseudomonas putida [TaxId: 160488]}
mhdvficdairtpigrfggalasvraddlaavplkaliernpgvqwdqvdevffgcanqa
gednrnvarmalllaglpesipgvtlnrlcasgmdavgtafraiasgemelviaggvesm
srapfvmgkaesaysrnmkledttigwrfinplmksqygvdsmpetadnvaddyqvsrad
qdafalrsqqkaaaaqaagffaeeivpvriahkkgeiiverdehlrpettlealtklkpv
ngpdktvtagnasgvndgaaamilasaaavkkhgl

SCOPe Domain Coordinates for d6pcbd1:

Click to download the PDB-style file with coordinates for d6pcbd1.
(The format of our PDB-style files is described here.)

Timeline for d6pcbd1: